PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 451aa    MW: 49974.7 Da    PI: 6.2616
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030531genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.91.1e-08237284552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  kr++r + NR +A rs +RK  +i eLe+ v++L+ae  +L  +l   
  Lus10030531 237 KRAKRIIANRQSAARSKERKARYILELERNVQNLQAEAATLGAQLTLF 284
                  9*************************************9998877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.630.105.3E-17268IPR001128Cytochrome P450
SuperFamilySSF482649.95E-17267IPR001128Cytochrome P450
PfamPF000672.4E-10260IPR001128Cytochrome P450
PROSITE patternPS000860817IPR017972Cytochrome P450, conserved site
SMARTSM003389.5E-15233297IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.887235298IPR004827Basic-leucine zipper domain
PfamPF001701.0E-6237281IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-9237292No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-7237299No hitNo description
CDDcd147035.71E-23238287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MHFELIPFGA GRRICPGIAF GMANVELPVA QLLYHFDWEL PDGVEDLDMT EDFAATMGRK  60
NPLWLVPRVH RFSNVREKDV EEKHMISTDD PIPNPNTTAE SPSANGGNSQ TPRGSFHRRA  120
FSEFQFRIPD DLDLDPLDPP SVTSFDELGS EDDLFYTYMD MGGGSLGSKP DDIDQKIDEA  180
AENPSSSGGG GGGGNKGVKG KHRHSNSVDG SSFVQSIEAK KAMGPDKLAE LWNMDPKRAK  240
RIIANRQSAA RSKERKARYI LELERNVQNL QAEAATLGAQ LTLFQRDTLG LTNENADLKL  300
RVQAMEQQAQ LREAVNDALR KEVEMLKIAT GERTAQQQLE YPYNMGMHHQ HHHLSYNHPP  360
FFPLHQQQPG NVMYNPHSIQ VPQFHPNNNL QSSRHLPTVT AALPNHHGRG FPEMLPHERL  420
QGLDISGGGG RSYVVVKSEG PSISASESNN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011316.11e-111Basic-leucine zipper transcription factor family protein isoform 2
SwissprotQ6S4P47e-81RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061FSP51e-111A0A061FSP5_THECC; Basic-leucine zipper transcription factor family protein isoform 2
STRINGVIT_13s0067g02900.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.17e-83bZIP family protein